Recombinant Staphylococcus aureus Tetracycline resistance protein tetM (tetM), partial | CSB-EP687481FKZ

Recombinant Staphylococcus aureus Tetracycline resistance protein tetM (tetM), partial | CSB-EP687481FKZ | Cusabio

Alternative Name(s): tetA(M)

Gene Names: tetM

Research Areas: Others

Organism: Staphylococcus aureus

AA Sequence: MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDFVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKSNIGIDNLIEVITNKFYSST

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-242aa

Sequence Info: Partial

MW: 32.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.

Reference: "Cloning and nucleotide sequence of a chromosomally encoded tetracycline resistance determinant, tetA(M), from a pathogenic, methicillin-resistant strain of Staphylococcus aureus." Nesin M., Svec P., Lupski J.R., Godson G.N., Kreiswirth B., Projan S.J. Antimicrob. Agents Chemother. 34:2273-2276(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.

Involvement in disease:

Subcellular Location:

Protein Families: TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, TetM/TetO subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q53770

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A