Cusabio Staphylococcus aureus Recombinants
Recombinant Staphylococcus aureus Enterotoxin type A (entA) | CSB-BP362952FKZ
- SKU:
- CSB-BP362952FKZ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Staphylococcus aureus Enterotoxin type A (entA) | CSB-BP362952FKZ | Cusabio
Alternative Name(s): SEA
Gene Names: entA
Research Areas: Cell Biology
Organism: Staphylococcus aureus
AA Sequence: SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 25-257aa
Sequence Info: Full Length of Mature Protein
MW: 31.0 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Reference: "Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction." Hakansson M., Antonsson P., Bjork P., Svensson L.A. J. Biol. Inorg. Chem. 6:757-762(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Staphylococcal/streptococcal toxin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P0A0L2
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A