Cusabio Staphylococcus aureus Recombinants
Recombinant Staphylococcus aureus Autolysin (lytA) | CSB-EP326479FKZ
- SKU:
- CSB-EP326479FKZ
- Availability:
- 13 - 23 Working Days
Description
Recombinant Staphylococcus aureus Autolysin (lytA) | CSB-EP326479FKZ | Cusabio
Alternative Name(s): N-acetylmuramoyl-L-alanine amidase
Gene Names: lytA
Research Areas: Others
Organism: Staphylococcus aureus
AA Sequence: MQAKLTKNEFIERLKTSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLDYIIVYEQNWLGGGWTDGIEQPAGVGKKLQDDNMLMISLCGLSVRILKVRQRHDQFNLLHKHPKKETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSKGATAEAYRNGLVNAPLSRLEAGIAHSYVSGNTVWQALDESQVGWHTANQIGNKYYYGIEVCQSMGADNATFLKNEQATFQECARLLKKWGLPANRNTIRLHNEFTSTSCPHRSSVLHTGFDPVTRGLLPEDKRLQLKDYFIKQIRAYMDGKIPVATVSNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPVGYQFQPGGYCDYTEVMLQDGHVWVGYTWEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-481aa
Sequence Info: Full Length
MW: 57.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation. Autolysin strictly depends on the presence of choline-containing cell walls for activity.
Reference: "Sequence analysis of a Staphylococcus aureus gene encoding a peptidoglycan hydrolase activity." Wang X., Wilkinson B.J., Jayaswal R.K. Gene 102:105-109(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation. Autolysin strictly depends on the presence of choline-containing cell walls for activity.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: N-acetylmuramoyl-L-alanine amidase 2 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P24556
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A