Recombinant Staphylococcus aureus Alpha-hemolysin (hly) | CSB-YP639324FLF

Recombinant Staphylococcus aureus Alpha-hemolysin (hly) | CSB-YP639324FLF | Cusabio

Alternative Name(s): Alpha-toxin

Gene Names: hly

Research Areas: Others

Organism: Staphylococcus aureus (strain NCTC 8325)

AA Sequence: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 27-319aa

Sequence Info: Full Length of Mature Protein

MW: 35.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Alpha-toxin binds to the mbrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity .

Reference: Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.Sibbald M.J., Winter T., van der Kooi-Pol M.M., Buist G., Tsompanidou E., Bosma T., Schafer T., Ohlsen K., Hecker M., Antelmann H., Engelmann S., van Dijl J.M.J. Bacteriol. 192:3788-3800(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Aerolysin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q2G1X0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A