Cusabio Shigella flexneri Recombinants
Recombinant Shigella flexneri Protein mxiH (mxiH) | CSB-EP363183SZB
- SKU:
- CSB-EP363183SZB
- Availability:
- 13 - 23 Working Days
Description
Recombinant Shigella flexneri Protein mxiH (mxiH) | CSB-EP363183SZB | Cusabio
Alternative Name(s): mxiH; CP0137; Protein MxiH
Gene Names: mxiH
Research Areas: Others
Organism: Shigella flexneri
AA Sequence: MSVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNFR
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-83aa
Sequence Info: Full Length
MW: 16.7 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance:
Reference: "Complete DNA sequence and analysis of the large virulence plasmid of Shigella flexneri." Venkatesan M.M., Goldberg M.B., Rose D.J., Grotbeck E.J., Burland V., Blattner F.R. Infect. Immun. 69:3271-3285(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P0A223
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A