Cusabio Shigella flexneri Recombinants
Recombinant Shigella flexneri Adenylate kinase (adk) | CSB-EP769467SZB
- SKU:
- CSB-EP769467SZB
- Availability:
- 3 - 7 Working Days
Description
Recombinant Shigella flexneri Adenylate kinase (adk) | CSB-EP769467SZB | Cusabio
Alternative Name(s): ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinase
Gene Names: adk
Research Areas: Signal Transduction
Organism: Shigella flexneri
AA Sequence: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-214aa
Sequence Info: Full Length
MW: 43.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Reference: "Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157." Jin Q., Yuan Z., Xu J., Wang Y., Shen Y., Lu W., Wang J., Liu H., Yang J., Yang F., Zhang X., Zhang J., Yang G., Wu H., Qu D., Dong J., Sun L., Xue Y. Yu J. Nucleic Acids Res. 30:4432-4441(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Adenylate kinase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q83M40
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A