Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB) | CSB-EP653424SGF

(No reviews yet) Write a Review
SKU:
CSB-EP653424SGF
Availability:
13 - 23 Working Days
  • Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP653424SGF could indicate that this peptide derived from E.coli-expressed Shigella dysenteriae serotype 1 (strain Sd197) stxB.
€352.00 - €1,702.00

Description

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB) | CSB-EP653424SGF | Cusabio

Alternative Name(s): stxB; SDY_1390; Shiga toxin subunit B

Gene Names: stxB

Research Areas: Signal Transduction

Organism: Shigella dysenteriae serotype 1 (strain Sd197)

AA Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-89aa

Sequence Info: Full Length of Mature Protein

MW: 15.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide in human intestinal microvilli.

Reference: "Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery." Yang F., Yang J., Zhang X., Chen L., Jiang Y., Yan Y., Tang X., Wang J., Xiong Z., Dong J., Xue Y., Zhu Y., Xu X., Sun L., Chen S., Nie H., Peng J., Xu J. Jin Q. Nucleic Acids Res. 33:6445-6458(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Involvement in disease:

Subcellular Location:

Protein Families: StxB family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q32GM0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose