Recombinant Sheep Somatoliberin (GHRH) | CSB-EP009412SH

Recombinant Sheep Somatoliberin (GHRH) | CSB-EP009412SH | Cusabio

Alternative Name(s): Growth hormone-releasing factor ;GRFGrowth hormone-releasing hormone ;GHRH

Gene Names: GHRH

Research Areas: Others

Organism: Ovis aries (Sheep)

AA Sequence: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-44aa

Sequence Info: Full Length

MW: 32.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

Reference: Growth hormone-releasing factor from ovine and caprine hypothalamus isolation, sequence analysis and total synthesis.Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.Biochem. Biophys. Res. Commun. 125:606-614(1984)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Glucagon family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07217

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A