Cusabio Ovis aries Recombinants
Recombinant Sheep Protransforming growth factor alpha (TGFA), partial | CSB-EP023445SH
- SKU:
- CSB-EP023445SH
- Availability:
- 13 - 23 Working Days
Description
Recombinant Sheep Protransforming growth factor alpha (TGFA), partial | CSB-EP023445SH | Cusabio
Alternative Name(s): EGF-like TGF ;ETGFTGF type 1
Gene Names: TGFA
Research Areas: Others
Organism: Ovis aries (Sheep)
AA Sequence: ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 24-97aa
Sequence Info: Extracellular Domain
MW: 34.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Reference: Growth factor expression in skin during wool follicle development.Sutton R., Ward W.G., Raphael K.A., Cam G.R.Comp. Biochem. Physiol. 110B:697-705(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Involvement in disease:
Subcellular Location: Transforming growth factor alpha: Secreted, extracellular space, SUBCELLULAR LOCATION: Protransforming growth factor alpha: Cell membrane, Single-pass type I membrane protein
Protein Families:
Tissue Specificity: Skin.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P98135
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A