Cusabio Saccharomyces cerevisiae Recombinants
Recombinant Saccharomyces cerevisiae Trehalose-phosphatase (TPS2), partial | CSB-RP165694Ye(c)
- SKU:
- CSB-RP165694Ye(c)
- Availability:
- 13 - 23 Working Days
Description
Recombinant Saccharomyces cerevisiae Trehalose-phosphatase (TPS2), partial | CSB-RP165694Ye(c) | Cusabio
Alternative Name(s): Trehalose synthase complex catalytic subunit TPS2Trehalose-6-phosphate phosphatase ;TPP
Gene Names: TPS2
Research Areas: Others
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence: GEFHAKELKEKLLSFTDDFDLEVMDGKANIEVRPRFVNKGEIVKRLVWHQHGKPQDMLKGISEKLPKDEMPDFVLCLGDDFTDEDMFRQLNTIETCWKEKYPDQKNQWGNYGFYPVTVGSASKKTVAKAHLTDPQQVLETLGLLVGDVSLFQSAGTVDLDSRGHVKNSESSLKSKLASKAYVMKRSASYTGAK
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 703-895aa
Sequence Info: Partial
MW: 25.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Phosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6-phosphate and UDP-glucose in a two step process.
Reference: Disruption of TPS2, the gene encoding the 100-KDA subunit of the trehalose-6-phosphate synthase/phosphatase complex in Saccharomyces cerevisiae, causes accumulation of trehalose-6-phosphate and loss of trehalose-6-phosphate phosphatase activity.de Virgilio C., Buerckert N., Bell W., Jenoe P., Boller T., Wiemken A.Eur. J. Biochem. 212:315-323(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Phosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6-phosphate and UDP-glucose in a two step process.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Glycosyltransferase 20 family; Trehalose phosphatase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P31688
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A