Recombinant Saccharomyces cerevisiae Trehalose-phosphatase (TPS2), partial | CSB-RP165694Ye(c)

(No reviews yet) Write a Review
SKU:
CSB-RP165694Ye(c)
Availability:
13 - 23 Working Days
  • Recombinant Saccharomyces cerevisiae Trehalose-phosphatase (TPS2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Saccharomyces cerevisiae Trehalose-phosphatase (TPS2), partial | CSB-RP165694Ye(c) | Cusabio

Alternative Name(s): Trehalose synthase complex catalytic subunit TPS2Trehalose-6-phosphate phosphatase ;TPP

Gene Names: TPS2

Research Areas: Others

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: GEFHAKELKEKLLSFTDDFDLEVMDGKANIEVRPRFVNKGEIVKRLVWHQHGKPQDMLKGISEKLPKDEMPDFVLCLGDDFTDEDMFRQLNTIETCWKEKYPDQKNQWGNYGFYPVTVGSASKKTVAKAHLTDPQQVLETLGLLVGDVSLFQSAGTVDLDSRGHVKNSESSLKSKLASKAYVMKRSASYTGAK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 703-895aa

Sequence Info: Partial

MW: 25.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Phosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6-phosphate and UDP-glucose in a two step process.

Reference: Disruption of TPS2, the gene encoding the 100-KDA subunit of the trehalose-6-phosphate synthase/phosphatase complex in Saccharomyces cerevisiae, causes accumulation of trehalose-6-phosphate and loss of trehalose-6-phosphate phosphatase activity.de Virgilio C., Buerckert N., Bell W., Jenoe P., Boller T., Wiemken A.Eur. J. Biochem. 212:315-323(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Phosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6-phosphate and UDP-glucose in a two step process.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Glycosyltransferase 20 family; Trehalose phosphatase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31688

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose