Cusabio Saccharomyces cerevisiae Recombinants
Recombinant Saccharomyces cerevisiae Alanine/arginine aminopeptidase (AAP1) , partial | CSB-EP327747SVG
- SKU:
- CSB-EP327747SVG
- Availability:
- 13 - 23 Working Days
Description
Recombinant Saccharomyces cerevisiae Alanine/arginine aminopeptidase (AAP1) , partial | CSB-EP327747SVG | Cusabio
Alternative Name(s): AAP1; YHR047CAlanine/arginine aminopeptidase; EC 3.4.11.-
Gene Names: AAP1
Research Areas: Cell Biology
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence: MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-389aa
Sequence Info: Partial
MW: 60.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Positive effector of glycogen accumulation. May be involved in nutrient-sensing.
Reference: Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Positive effector of glycogen accumulation. May be involved in nutrient-sensing.
Involvement in disease:
Subcellular Location:
Protein Families: Peptidase M1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P37898
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A