Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1) | CSB-YP006519SVG

(No reviews yet) Write a Review
SKU:
CSB-YP006519SVG
Availability:
3 - 7 Working Days
  • Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €2,023.00

Description

Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1) | CSB-YP006519SVG | Cusabio

Alternative Name(s): Short name:ACBP

Gene Names: ACB1

Research Areas: Others

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-87aa

Sequence Info: Full Length

MW: 12.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.

Reference: "Quantitative trait loci mapped to single-nucleotide resolution in yeast."Deutschbauer A.M., Davis R.W.Nat. Genet. 37:1333-1340(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.

Involvement in disease:

Subcellular Location:

Protein Families: ACBP family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31787

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose