Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial | CSB-EP706579RMS

Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial | CSB-EP706579RMS | Cusabio

Alternative Name(s): 190KDA antigen Cell surface antigen rOmp A

Gene Names: ompA

Research Areas: Microbiology

Organism: Rickettsia conorii (strain ATCC VR-613 / Malish 7)

AA Sequence: DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1734-2021aa

Sequence Info: Partial

MW: 51.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Elicits protective immunity.

Reference: "Differentiation of spotted fever group rickettsiae by sequencing and analysis of restriction fragment length polymorphism of PCR-amplified DNA of the gene encoding the protein rOmpA." Roux V., Fournier P.E., Raoult D. J. Clin. Microbiol. 34:2058-2065(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Elicits protective immunity.

Involvement in disease:

Subcellular Location: Outer membrane protein A: Periplasm, SUBCELLULAR LOCATION: 120 kDa surface-exposed protein: Secreted, Cell surface, Note=Surface exposed, This bacterium is covered by a S-layer with hexagonal symmetry, SUBCELLULAR LOCATION: 32 kDa beta peptide: Cell outer membrane, Multi-pass membrane protein

Protein Families: Rickettsiae OmpA/OmpB family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q52657

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A