Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2) | CSB-EP012027RA

(No reviews yet) Write a Review
SKU:
CSB-EP012027RA
Availability:
13 - 23 Working Days
  • Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2) | CSB-EP012027RA | Cusabio

Alternative Name(s): MinK-related peptide 1Minimum potassium ion channel-related peptide 1;Potassium channel subunit beta MiRP1

Gene Names: Kcne2

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-123aa

Sequence Info: Full Length

MW: 18.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ancillary protein that assbles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KCLQT1 and elicit a voltage-independent current .

Reference: MinK-related peptide 1 a beta subunit for the HCN ion channel subunit family enhances expression and speeds activation.Yu H., Wu J., Potapova I., Wymore R.T., Holmes B., Zuckerman J., Pan Z., Wang H., Shi W., Robinson R.B., El-Maghrabi M.R., Benjamin W., Dixon J.E., McKinnon D., Cohen I.S., Wymore R.Circ. Res. 88:E84-E87(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Potassium channel KCNE family

Tissue Specificity: Expressed in the heart (PubMed:19219384).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P63161

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose