Recombinant Rat Phospholipase A2, membrane associated (Pla2g2a) | CSB-YP321246RA

Recombinant Rat Phospholipase A2, membrane associated (Pla2g2a) | CSB-YP321246RA | Cusabio

Alternative Name(s): GIIC sPLA2Group IIA phospholipase A2;Phosphatidylcholine 2-acylhydrolase 2A

Gene Names: Pla2g2a

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-146aa

Sequence Info: Full Length of Mature Protein

MW: 16.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Reference: Structure of cDNA coding for rat platelet phospholipase A2.Komada M., Kudo I., Mizushima H., Kitamura N., Inoue K.J. Biochem. 106:545-547(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides

Involvement in disease:

Subcellular Location: Cell membrane, Peripheral membrane protein, Secreted

Protein Families: Phospholipase A2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14423

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A