Cusabio Rattus norvegicus Recombinants
Recombinant Rat Osteocrin (Ostn), partial | CSB-EP017269RA
- SKU:
- CSB-EP017269RA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Osteocrin (Ostn), partial | CSB-EP017269RA | Cusabio
Alternative Name(s): Musclin
Gene Names: Ostn
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 82-131aa
Sequence Info: Partial
MW: 21.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle
Reference: "Osteocrin, a novel bone-specific secreted protein that modulates the osteoblast phenotype."Thomas G., Moffatt P., Salois P., Gaumond M.-H., Gingras R., Godin E., Miao D., Goltzman D., Lanctot C.J. Biol. Chem. 278:50563-50571(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production. Required to enhance physical endurance
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Osteocrin family
Tissue Specificity: Highly expressed in skeletal muscle (PubMed:15044443). Also expressed in leg tendons/ligaments and osteoblasts (PubMed:17951249). In long bones and teeth, present in knee joint and periodontal ligaments (at protein level) (PubMed:17951249).
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P61365
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A