Recombinant Rat Osteocalcin (Bglap) | CSB-EP002682RA

Recombinant Rat Osteocalcin (Bglap) | CSB-EP002682RA | Cusabio

Alternative Name(s): Bone Gla protein ;BGPGamma-carboxyglutamic acid-containing protein

Gene Names: Bglap

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 50-99aa

Sequence Info: Full Length of Mature Protein

MW: 32.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Reference: Structure of the rat osteocalcin gene and regulation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Osteocalcin/matrix Gla protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04640

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A