Recombinant Rat Oncostatin-M (Osm) | CSB-EP723970RAb0

Recombinant Rat Oncostatin-M (Osm) | CSB-EP723970RAb0 | Cusabio

Alternative Name(s): OSM

Gene Names: Osm

Research Areas: Immunology

Organism: Rattus norvegicus (Rat)

AA Sequence: KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 26-208aa

Sequence Info: Full Length of Mature Protein

MW: 26.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor. Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Reference: "Oncostatin M inhibits proliferation of rat oval cells, OC15-5, inducing differentiation into hepatocytes." Okaya A., Kitanaka J., Kitanaka N., Satake M., Kim Y., Terada K., Sugiyama T., Takemura M., Fujimoto J., Terada N., Miyajima A., Tsujimura T. Am. J. Pathol. 166:709-719(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q65Z15

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A