Cusabio Rattus norvegicus Recombinants
Recombinant Rat H-2 class II histocompatibility antigen gamma chain (Cd74) , partial | CSB-EP004956RA
- SKU:
- CSB-EP004956RA
- Availability:
- 13 - 23 Working Days
Description
Recombinant Rat H-2 class II histocompatibility antigen gamma chain (Cd74) , partial | CSB-EP004956RA | Cusabio
Alternative Name(s): Ia antigen-associated invariant chain ;IiMHC class II-associated invariant chain; CD74
Gene Names: Cd74
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 57-280aa
Sequence Info: Extracellular Domain
MW: 29.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
Reference: Nucleotide sequence of rat invariant gamma chain cDNA clone pLR gamma 34.3.Henkes W., Syha J., Reske K.Nucleic Acids Res. 16:11822-11822(1988)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type II membrane protein
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P10247
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A