Recombinant Rat Glutathione S-transferase P (Gstp1) | CSB-EP009989RA

Recombinant Rat Glutathione S-transferase P (Gstp1) | CSB-EP009989RA | Cusabio

Alternative Name(s): Chain 7GST 7-7GST class-pi

Gene Names: Gstp1

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-210aa

Sequence Info: Full Length of Mature Protein

MW: 27.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration .

Reference: Cloning and the nucleotide sequence of rat glutathione S-transferase P cDNA.Suguoka Y., Kano T., Okuda A., Sakai M., Kitagawa T., Muramatsu M.Nucleic Acids Res. 13:6049-6057(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Mitochondrion, Nucleus

Protein Families: GST superfamily, Pi family

Tissue Specificity: Present in kidney, lung, testis and placenta, very low levels in liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04906

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A