Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial | CSB-BP009514RA1

Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial | CSB-BP009514RA1 | Cusabio

Alternative Name(s): Glpr

Gene Names: Glp1r

Research Areas: Neuroscience

Organism: Rattus norvegicus (Rat)

AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

Expression Region: 22-135aa

Sequence Info: Partial

MW: 15.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1

Reference: "Exendin-4 stimulates both beta-cell replication and neogenesis, resulting in increased beta-cell mass and improved glucose tolerance in diabetic rats." Xu G., Stoffers D.A., Habener J.F., Bonner-Weir S. Diabetes 48:2270-2276(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 2 family

Tissue Specificity: Pancreatic islets, stomach, lung, rat insulinoma cell line.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P32301

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A