Recombinant Rat Gamma-crystallin B (Crygb) | CSB-YP006018RA

(No reviews yet) Write a Review
SKU:
CSB-YP006018RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Gamma-crystallin B (Crygb)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00

Description

Recombinant Rat Gamma-crystallin B (Crygb) | CSB-YP006018RA | Cusabio

Alternative Name(s): Gamma-B-crystallin Gamma-crystallin 1-2

Gene Names: Crygb

Research Areas: Neuroscience

Organism: Rattus norvegicus (Rat)

AA Sequence: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-175aa

Sequence Info: Full Length of Mature Protein

MW: 23 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Crystallins are the dominant structural components of the vertebrate eye lens.

Reference: "Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region." den Dunnen J.T., van Neck J.W., Cremers F.P.M., Lubsen N.H., Schoenmakers J.G.G. Gene 78:201-213(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Crystallins are the dominant structural components of the vertebrate eye lens.

Involvement in disease:

Subcellular Location:

Protein Families: Beta/gamma-crystallin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10066

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose