Cusabio Rattus norvegicus Recombinants
Recombinant Rat Amphoterin-induced protein 3 (Amigo3) | CSB-MP802260RA
- SKU:
- CSB-MP802260RA
- Availability:
- 18 - 28 Working Days
Description
Recombinant Rat Amphoterin-induced protein 3 (Amigo3) | CSB-MP802260RA | Cusabio
Alternative Name(s): AMIGO-3 Alivin-3
Gene Names: Amigo3
Research Areas: Cell Biology
Organism: Rattus norvegicus (Rat)
AA Sequence: TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCSVAAAPGLELPEEELHTHVGQSLRLFCNTTVPAARVAWVSPKNELLVAPGSQDGSIAVLADGSLAIGRVQEQHAGLFVCLASGPRLHHNQTLEYNVSVHKPRPEPEAFNT
Source: Mammalian cell
Tag Info: N-terminal 6xHis-tagged
Expression Region: 20-383aa
Sequence Info: Full Length of Mature Protein
MW: 44.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.
Reference: "AMIGO, a transmembrane protein implicated in axon tract development, defines a novel protein family with leucine-rich repeats."Kuja-Panula J., Kiiltomaeki M., Yamashiro T., Rouhiainen A., Rauvala H.J. Cell Biol. 160:963-973(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families: Immunoglobulin superfamily, AMIGO family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q80ZD5
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A