Recombinant Rat Amphoterin-induced protein 3 (Amigo3) | CSB-MP802260RA

Recombinant Rat Amphoterin-induced protein 3 (Amigo3) | CSB-MP802260RA | Cusabio

Alternative Name(s): AMIGO-3 Alivin-3

Gene Names: Amigo3

Research Areas: Cell Biology

Organism: Rattus norvegicus (Rat)

AA Sequence: TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCSVAAAPGLELPEEELHTHVGQSLRLFCNTTVPAARVAWVSPKNELLVAPGSQDGSIAVLADGSLAIGRVQEQHAGLFVCLASGPRLHHNQTLEYNVSVHKPRPEPEAFNT

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-383aa

Sequence Info: Full Length of Mature Protein

MW: 44.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.

Reference: "AMIGO, a transmembrane protein implicated in axon tract development, defines a novel protein family with leucine-rich repeats."Kuja-Panula J., Kiiltomaeki M., Yamashiro T., Rouhiainen A., Rauvala H.J. Cell Biol. 160:963-973(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily, AMIGO family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q80ZD5

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A