Cusabio Rattus norvegicus Recombinants
Recombinant Rat Alpha-synuclein (Snca) | CSB-EP021912RAe0
- SKU:
- CSB-EP021912RAe0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Alpha-synuclein (Snca) | CSB-EP021912RAe0 | Cusabio
Alternative Name(s): Snca; Alpha-synuclein
Gene Names: Snca
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-140aa
Sequence Info: Full Length
MW: 41.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May be involved in the regulation of dopamine release and transport.
Reference: The UCH-L1 gene encodes two opposing enzymatic activities that affect alpha-synuclein degradation and Parkinson's disease susceptibility.Liu Y., Fallon L., Lashuel H.A., Liu Z., Lansbury P.T. Jr.Cell 111:209-218(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May be involved in the regulation of dopamine release and transport.
Involvement in disease:
Subcellular Location: Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted
Protein Families: Synuclein family
Tissue Specificity: Found only in brain (hippocampus, brainstem and cortex). Specifically expressed in neuronal cell bodies and synapses.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P37377
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A