Recombinant Rabies virus Matrix protein (M) | CSB-YP322192RAI

Recombinant Rabies virus Matrix protein (M) | CSB-YP322192RAI | Cusabio

Alternative Name(s): Phosphoprotein M2

Gene Names: M

Research Areas: Others

Organism: Rabies virus (strain PM) (RABV)

AA Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-202aa

Sequence Info: Full Length

MW: 25.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a major role in assbly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons .

Reference: Sequence of the 3386 3' nucleotides of the genome of the AVO1 strain rabies virus structural similarities in the protein regions involved in transcription.Poch O., Tordo N., Keith G.Biochimie 70:1019-1029(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity).

Involvement in disease:

Subcellular Location: Virion membrane, Peripheral membrane protein, Host endomembrane system, Peripheral membrane protein

Protein Families: Lyssavirus matrix protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15200

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A