Cusabio Rabies virus Recombinants
Recombinant Rabies virus Matrix protein (M) | CSB-EP322192RAI
- SKU:
- CSB-EP322192RAI
- Availability:
- 13 - 23 Working Days
Description
Recombinant Rabies virus Matrix protein (M) | CSB-EP322192RAI | Cusabio
Alternative Name(s): Phosphoprotein M2
Gene Names: M
Research Areas: Others
Organism: Rabies virus (strain PM1503/AVO1) (RABV)
AA Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
Expression Region: 1-202aa
Sequence Info: Full Length
MW: 37.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons
Reference: "Sequence of the 3386 3' nucleotides of the genome of the AVO1 strain rabies virus: structural similarities in the protein regions involved in transcription." Poch O., Tordo N., Keith G. Biochimie 70:1019-1029(1988)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity).
Involvement in disease:
Subcellular Location: Virion membrane, Peripheral membrane protein, Host endomembrane system, Peripheral membrane protein
Protein Families: Lyssavirus matrix protein family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P15200
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A