Cusabio Oryctolagus cuniculus Recombinants
Recombinant Rabbit Integrin beta-8 (ITGB8), partial | CSB-YP011892RB
- SKU:
- CSB-YP011892RB
- Availability:
- 25 - 35 Working Days
Description
Recombinant Rabbit Integrin beta-8 (ITGB8), partial | CSB-YP011892RB | Cusabio
Alternative Name(s): ITGB8Integrin beta-8
Gene Names: ITGB8
Research Areas: Signal Transduction
Organism: Oryctolagus cuniculus (Rabbit)
AA Sequence: PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL
Source: Yeast
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
Expression Region: 146-384aa
Sequence Info: Partial
MW: 30.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Integrin alpha-V/beta-8 is a receptor for fibronectin.
Reference: "Cloning and expression of a divergent integrin subunit beta 8." Moyle M., Napier M.A., McLean J.W. J. Biol. Chem. 266:19650-19658(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Integrin alpha-V/beta-8 is a receptor for fibronectin.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families: Integrin beta chain family
Tissue Specificity: Placenta, kidney, brain, ovary, uterus and in several transformed cells.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P26013
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A