Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain | CSB-YP018091EZTa4

Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain | CSB-YP018091EZTa4 | Cusabio

Alternative Name(s): Phosphatidylcholine 2-acylhydrolase

Gene Names: N/A

Research Areas: Others

Organism: Pseudechis porphyriacus (Red-bellied black snake)

AA Sequence: NLIQFSNMIKCAIPGSRPLFQYADYGCYCGPGGHGTPVDELDRCCKIHDDCYGEAGKKGCFPKLTLYSWKCTEKVPTCNAKSRCKDFVCACDAEAAKCFAKAPYIKENYNINTKTRC

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 1-117aa

Sequence Info: Full Length

MW: 29 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Reference: "Purification, sequencing and characterization of pseudexin phospholipases A2 from Pseudechis porphyriacus (Australian red-bellied black snake)." Schmidt J.J., Middlebrook J.L. Toxicon 27:805-818(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Phospholipase A2 family, Group I subfamily, D49 sub-subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20259

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A