Recombinant Prunus persica Non-specific lipid-transfer protein 1 | CSB-EP305877EZK

(No reviews yet) Write a Review
SKU:
CSB-EP305877EZK
Availability:
13 - 23 Working Days
  • Recombinant Prunus persica Non-specific lipid-transfer protein 1
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Prunus persica Non-specific lipid-transfer protein 1 | CSB-EP305877EZK | Cusabio

Alternative Name(s): Allergen Pru p 1 Major allergen Pru p 3 Allergen: Pru p 3

Gene Names: N/A

Research Areas: Allergen

Organism: Prunus persica (Peach) (Amygdalus persica)

AA Sequence: ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-91aa

Sequence Info: Full Length

MW: 25.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Reference: "Complete amino acid sequence determination of the major allergen of peach (Prunus persica) Pru p 1."Pastorello E.A., Ortolani C., Baroglio C., Pravettoni V., Ispano M., Giuffrida M.G., Fortunato D., Farioli L., Monza M., Napolitano L., Sacco M., Scibola E., Conti A.Biol. Chem. 380:1315-1320(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Involvement in disease:

Subcellular Location:

Protein Families: Plant LTP family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P81402

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose