Recombinant Porcine reproductive and respiratory syndrome virus Nucleocapsid protein (ORF7) | CSB-EP2163

(No reviews yet) Write a Review
SKU:
CSB-EP2163
Availability:
13 - 23 Working Days
  • Recombinant Porcine reproductive and respiratory syndrome virus Nucleocapsid protein (ORF7)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€406.00 - €1,810.00

Description

Recombinant Porcine reproductive and respiratory syndrome virus Nucleocapsid protein (ORF7) | CSB-EP2163 | Cusabio

Alternative Name(s): /

Gene Names: ORF7

Research Areas: Others

Organism: Porcine reproductive and respiratory syndrome virus (PRRSV)

AA Sequence: MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA

Source: E.coli

Tag Info: Tag-Free

Expression Region: 1-123aa

Sequence Info: Full Length

MW: 13.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Genetic dissection of complete genomes of Type 2 PRRS viruses isolated in Denmark over a period of 15 years." Kvisgaard L.K., Hjulsager C.K., Brar M.S., Leung F.C., Larsen L.E. Vet. Microbiol. 167:334-344(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: V5N6H2

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose