Cusabio Plasmodium falciparum Recombinants
Recombinant Plasmodium falciparum Plasmepsin-1 | CSB-EP340172PLO
- SKU:
- CSB-EP340172PLO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Plasmodium falciparum Plasmepsin-1 | CSB-EP340172PLO | Cusabio
Alternative Name(s): Aspartic hemoglobinase I (PfAPG)
Gene Names: N/A
Research Areas: Others
Organism: Plasmodium falciparum
AA Sequence: AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 125-452aa
Sequence Info: Full Length of Mature Protein
MW: 41.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Participates in the digestion of the host hemoglobin. Initial cleavage at the hinge region of hemoglobin, than cleaves at other sites, leading to denaturation of the molecule and to further degradation.
Reference: "Crystal structures of the free and inhibited forms of plasmepsin I (PMI) from Plasmodium falciparum." Bhaumik P., Horimoto Y., Xiao H., Miura T., Hidaka K., Kiso Y., Wlodawer A., Yada R.Y., Gustchina A. J. Struct. Biol. 175:73-84(2011)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P39898
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A