Cusabio Sus scrofa Recombinants
Recombinant Pig Vascular endothelial growth factor A (VEGFA) | CSB-EP025833PI
- SKU:
- CSB-EP025833PI
- Availability:
- 3 - 7 Working Days
Description
Recombinant Pig Vascular endothelial growth factor A (VEGFA) | CSB-EP025833PI | Cusabio
Alternative Name(s): Vascular permeability factor ;VPF
Gene Names: VEGFA
Research Areas: Others
Organism: Sus scrofa (Pig)
AA Sequence: APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 27-190aa
Sequence Info: Full Length of Mature Protein
MW: 23.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin .
Reference: Nucleotide sequence and expression of the porcine vascular endothelial growth factor.Sharma H.S., Tang Z.H., Gho B.C.H., Verdouw P.D.Biochim. Biophys. Acta 1260:235-238(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin (By similarity). Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: PDGF/VEGF growth factor family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P49151
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A