Recombinant Pig Vascular endothelial growth factor A (VEGFA) | CSB-EP025833PI

Recombinant Pig Vascular endothelial growth factor A (VEGFA) | CSB-EP025833PI | Cusabio

Alternative Name(s): Vascular permeability factor ;VPF

Gene Names: VEGFA

Research Areas: Others

Organism: Sus scrofa (Pig)

AA Sequence: APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 27-190aa

Sequence Info: Full Length of Mature Protein

MW: 23.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin .

Reference: Nucleotide sequence and expression of the porcine vascular endothelial growth factor.Sharma H.S., Tang Z.H., Gho B.C.H., Verdouw P.D.Biochim. Biophys. Acta 1260:235-238(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin (By similarity). Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: PDGF/VEGF growth factor family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49151

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A