Recombinant Pig Prolactin (PRL) | CSB-YP018724PI

(No reviews yet) Write a Review
SKU:
CSB-YP018724PI
Availability:
25 - 35 Working Days
  • Recombinant Pig Prolactin (PRL)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Pig Prolactin (PRL) | CSB-YP018724PI | Cusabio

Alternative Name(s): PRL; Prolactin; PRL

Gene Names: PRL

Research Areas: Others

Organism: Sus scrofa (Pig)

AA Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-229aa

Sequence Info: Full Length of Mature Protein

MW: 25 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Prolactin acts primarily on the mammary gland by promoting lactation.

Reference: Nucleotide sequence of porcine preprolactin cDNA.Schulz Aellen M.F., Schmid E., Movva R.N.Nucleic Acids Res. 17:3295-3295(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Prolactin acts primarily on the mammary gland by promoting lactation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Somatotropin/prolactin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01238

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose