Recombinant Pig Parathyroid hormone (PTH) | CSB-MP018987PI

Recombinant Pig Parathyroid hormone (PTH) | CSB-MP018987PI | Cusabio

Alternative Name(s): GTR2-2 Intestinal protein OCI-5 MXR7

Gene Names: PTH

Research Areas: Signal Transduction

Organism: Sus scrofa (Pig)

AA Sequence: MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQGRPCLPEWDHILCWP

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 32-115aa

Sequence Info: Full Length of Mature Protein

MW: 13.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition (By similarity).

Reference: "Mapping of chimpanzee full-length cDNAs onto the human genome unveils large potential divergence of the transcriptome."Sakate R., Suto Y., Imanishi T., Tanoue T., Hida M., Hayasaka I., Kusuda J., Gojobori T., Hashimoto K., Hirai M.Gene 399:1-10(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P50133

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A