Cusabio Virus & Bacteria Recombinants
Recombinant Phleum pratense Pollen allergen Phl p 5a, partial | CSB-EP669216EUQ
- SKU:
- CSB-EP669216EUQ
- Availability:
- 13 - 23 Working Days
Description
Recombinant Phleum pratense Pollen allergen Phl p 5a, partial | CSB-EP669216EUQ | Cusabio
Alternative Name(s): Allergen Phl p Va Allergen: Phl p 5a
Gene Names: N/A
Research Areas: Allergen
Organism: Phleum pratense (Common timothy)
AA Sequence: ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-286aa
Sequence Info: Partial
MW: 44.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Major allergen Phl p Va (timothy grass) bears at least two different IgE-reactive epitopes."Bufe A., Becker W.M., Schramm G., Petersen A., Mamat U., Schlaak M.J. Allergy Clin. Immunol. 94:173-181(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Poa p IX/Phl p VI allergen family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q40962
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A