Recombinant Petrosia ficiformis Silicatein | CSB-EP740986PGAQ

Recombinant Petrosia ficiformis Silicatein | CSB-EP740986PGAQ | Cusabio

Alternative Name(s): ; Silicatein; EC 3.4.22.-

Gene Names: N/A

Research Areas: Others

Organism: Petrosia ficiformis(Common Mediterranean sponge)

AA Sequence: LPETVDWRTGGAVTHVKDQLRCGCSYAFAAVGALEGAAALARGRTASLSEQNVLDCSVPYGNHGCSCEDVNNAFMYVIDNGGLDTTSSYPYVSRQYYCKFKSSGVGATATGIVTISSGDESSLESALATAGPVAVYIDASHSSFQFYKYGVLNVPNCSRSKLSHAMILIGYGTTSSKKYWLLKNSWGPNWGISGYIKMSRGMSNQCGIATYASFPTL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 123-339aa

Sequence Info: Full Length of Mature Protein

MW: 30.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Polymerizes silica around the axial filament during spicule formation.

Reference: "Primary structure and post-translational modifications of silicatein beta from the marine sponge Petrosia ficiformis (Poiret, 1789)." Armirotti A., Damonte G., Pozzolini M., Mussino F., Cerrano C., Salis A., Benatti U., Giovine M. J. Proteome Res. 8:3995-4004(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6YD92

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A