Cusabio Virus & Bacteria Recombinants
Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) | CSB-EP345923ESB
- SKU:
- CSB-EP345923ESB
- Availability:
- 3 - 7 Working Days
Description
Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) | CSB-EP345923ESB | Cusabio
Alternative Name(s): Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen: Par j 2.0101
Gene Names: LTP2
Research Areas: Others
Organism: Parietaria judaica (Pellitory-of-the-wall?(Parietaria diffusa)
AA Sequence: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 32-133aa
Sequence Info: Full Length of Mature Protein
MW: 27.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Reference: "Assignment of disulphide bridges in Par j 2.0101, a major allergen of Parietaria judaica pollen." Amoresano A., Pucci P., Duro G., Colombo P., Costa M.A., Izzo V., Lamba D., Geraci D. Biol. Chem. 384:1165-1172(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Involvement in disease:
Subcellular Location:
Protein Families: Plant LTP family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P55958
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A