Recombinant Ophiostoma ulmi CeRato-ulmin (CU) | CSB-YP313268OBS

(No reviews yet) Write a Review
SKU:
CSB-YP313268OBS
Availability:
25 - 35 Working Days
  • Recombinant Ophiostoma ulmi CeRato-ulmin (CU)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Ophiostoma ulmi CeRato-ulmin (CU) | CSB-YP313268OBS | Cusabio

Alternative Name(s): Dutch elm disease toxin

Gene Names: CU

Research Areas: Others

Organism: Ophiostoma ulmi (Dutch elm disease fungus)

AA Sequence: SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-100aa

Sequence Info: Full Length of Mature Protein

MW: 9.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

Reference: "Isolation and characterization of the cerato-ulmin toxin gene of the Dutch elm disease pathogen, Ophiostoma ulmi."Bowden C.G., Hintz W.E., Jeng R., Hubbes M., Horgen P.A.Curr. Genet. 25:323-329(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

Involvement in disease:

Subcellular Location: Secreted, cell wall

Protein Families: Cerato-ulmin hydrophobin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q06153

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose