Cusabio Virus & Bacteria Recombinants
Recombinant Ophiostoma ulmi CeRato-ulmin (CU) | CSB-YP313268OBS
- SKU:
- CSB-YP313268OBS
- Availability:
- 25 - 35 Working Days
Description
Recombinant Ophiostoma ulmi CeRato-ulmin (CU) | CSB-YP313268OBS | Cusabio
Alternative Name(s): Dutch elm disease toxin
Gene Names: CU
Research Areas: Others
Organism: Ophiostoma ulmi (Dutch elm disease fungus)
AA Sequence: SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 26-100aa
Sequence Info: Full Length of Mature Protein
MW: 9.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.
Reference: "Isolation and characterization of the cerato-ulmin toxin gene of the Dutch elm disease pathogen, Ophiostoma ulmi."Bowden C.G., Hintz W.E., Jeng R., Hubbes M., Horgen P.A.Curr. Genet. 25:323-329(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.
Involvement in disease:
Subcellular Location: Secreted, cell wall
Protein Families: Cerato-ulmin hydrophobin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q06153
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A