Recombinant Nosema bombycis Polar tube protein 3 (PTP3), partial | CSB-RP125444h

Recombinant Nosema bombycis Polar tube protein 3 (PTP3), partial | CSB-RP125444h | Cusabio

Alternative Name(s): /

Gene Names: PTP3

Research Areas: Signal Transduction

Organism: Nosema bombycis (strain CQ1 / CVCC 102059) (Microsporidian parasite) (Pebrine of silkworm)

AA Sequence: EIKSVIPEDRDEYSIDRSVIKFPLKTFIDEEVSNVGEAYVKNKKQSINDEVRNKVTTTNVNSGLNVIETENGFLNLGENSKKIHIDEATAYFKPAAKLKMEKKGIKTDNFRPKTNQGEIRDMPKGETYYEVDLKDADLSLPSPTNPTPDTLVSNGKDVVDVEDVSAIVINKGTLVQTPWNEYSDMIKPKFNPYPNEGEKINQIKKLQKLIADEKRKDTLDRIKVNTITNPDGEKRMIVNTPYGVQEMFEETEGMKRLSHIDPNKNVAISETPTDDNKESIYSAFKNVSPNEAVGKFIEDTFNSAYSSGQAQRFVNPTNAFTGQEDPKKARLMTQKTIDVTEYYINDGKPSSAIKNQLIQNYRALADSLGMTEEDFIQFARKIPDDSLAQMISYNEQSESSRPALVDAPFFKTLQPLANQTSKTKLNDIIKIIFTQISKVTGKTNSTTGTTLEKKIVPNLKAVRSDQVIAGPNGGTSALSQATAPRTGSTVLSKQITRGLPRVPSGTGTSYPVRDPNGINTSEDNERYKVNPYNPYSKSDTSGLEAPGGEIVHNGTRPSPYAIVGVPIVAAVTTPVIRPAVLRTPPAAQSSSSALQGNTALTGAGTPRAGVAGSPGVNPGPTGKAPVSPPAPT

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 700-1331aa

Sequence Info: Partial

MW: 95.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Comparative genomics of parasitic silkworm microsporidia reveal an association between genome expansion and host adaptation.Pan G., Xu J., Li T., Xia Q., Liu S.L., Zhang G., Li S., Li C., Liu H., Yang L., Liu T., Zhang X., Wu Z., Fan W., Dang X., Xiang H., Tao M., Li Y. , Hu J., Li Z., Lin L., Luo J., Geng L., Wang L., Long M., Wan Y., He N., Zhang Z., Lu C., Keeling P.J., Wang J., Xiang Z., Zhou Z.BMC Genomics 14:186-186(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: R0KX08

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A