Recombinant Neosartorya fumigata Probable glycosidase crf1 (crf1), partial | CSB-EP818279NGS1

(No reviews yet) Write a Review
SKU:
CSB-EP818279NGS1
Availability:
3 - 7 Working Days
  • Recombinant Neosartorya fumigata Probable glycosidase crf1 (crf1), partial
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP818279NGS1 could indicate that this peptide derived from E.coli-expressed Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) crf1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP818279NGS1 could indicate that this peptide derived from E.coli-expressed
€352.00 - €1,702.00

Description

Recombinant Neosartorya fumigata Probable glycosidase crf1 (crf1), partial | CSB-EP818279NGS1 | Cusabio

Alternative Name(s): Crh-like protein 1 (Allergen: Asp f 9)

Gene Names: crf1

Research Areas: Metabolism

Organism: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

AA Sequence: TYTADFTSASALDQWEVTAGKVPVGPQGAEFTVAKQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPY

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 42-233aa

Sequence Info: Partial

MW: 28.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Structures of the glycosylphosphatidylinositol membrane anchors from Aspergillus fumigatus membrane proteins." Fontaine T., Magnin T., Melhert A., Lamont D., Latge J.-P., Ferguson M.A.J. Glycobiology 13:169-177(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor, Secreted, cell wall

Protein Families: Glycosyl hydrolase 16 family, CRH1 subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8J0P4

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose