Cusabio Mycoplasma pneumoniae Recombinants
Recombinant Mycoplasma pneumoniae Chaperone protein DnaK (dnaK) , partial | CSB-EP301110MLW
- SKU:
- CSB-EP301110MLW
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mycoplasma pneumoniae Chaperone protein DnaK (dnaK) , partial | CSB-EP301110MLW | Cusabio
Alternative Name(s): HSP70 Heat shock 70KDA protein Heat shock protein 70
Gene Names: dnaK
Research Areas: Signal Transduction
Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
AA Sequence: QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 423-595aa
Sequence Info: Partial
MW: 35.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Acts as a chaperone.
Reference: "Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as a chaperone.
Involvement in disease:
Subcellular Location:
Protein Families: Heat shock protein 70 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P75344
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A