Recombinant Mycoplasma genitalium High affinity transport system protein p37 (p37) | CSB-EP675437MLN

(No reviews yet) Write a Review
SKU:
CSB-EP675437MLN
Availability:
13 - 23 Working Days
  • Recombinant Mycoplasma genitalium High affinity transport system protein p37 (p37)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Mycoplasma genitalium High affinity transport system protein p37 (p37) | CSB-EP675437MLN | Cusabio

Alternative Name(s): p37; MG289; High affinity transport system protein p37

Gene Names: p37

Research Areas: Others

Organism: Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

AA Sequence: CATKSDNTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYGK

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 26-368aa

Sequence Info: Full Length of Mature Protein

MW: 44.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: P37 is part of a high-affinity transport system.

Reference: "Insights into Mycoplasma genitalium metabolism revealed by the structure of MG289, an extracytoplasmic thiamine binding lipoprotein." Sippel K.H., Venkatakrishnan B., Boehlein S.K., Sankaran B., Quirit J.G., Govindasamy L., Agbandje-McKenna M., Goodison S., Rosser C.J., McKenna R. Proteins 79:528-536(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: P37 is part of a high-affinity transport system.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q49410

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose