Cusabio Mycobacterium tuberculosis Recombinants
Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) | CSB-EP363615MVZ
- SKU:
- CSB-EP363615MVZ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) | CSB-EP363615MVZ | Cusabio
Alternative Name(s): mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen
Gene Names: mpt51
Research Areas: Others
Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
AA Sequence: AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 27-299aa
Sequence Info: Full Length of Mature Protein
MW: 44.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.
Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Mycobacterial A85 antigen family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P9WQN6
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A