Recombinant Mycobacterium tuberculosis Malate synthase G (glcB), partial | CSB-EP403987MON

(No reviews yet) Write a Review
SKU:
CSB-EP403987MON
Availability:
13 - 23 Working Days
  • Recombinant Mycobacterium tuberculosis Malate synthase G (glcB), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€406.00 - €1,810.00

Description

Recombinant Mycobacterium tuberculosis Malate synthase G (glcB), partial | CSB-EP403987MON | Cusabio

Alternative Name(s): glcB; MRA_1848Malate synthase G; EC 2.3.3.9

Gene Names: glcB

Research Areas: Others

Organism: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

AA Sequence: GSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPESQVGTTDRAGVKDVILE

Source: E.coli

Tag Info: Tag-Free

Expression Region: 136-263aa

Sequence Info: Partial

MW: 13.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA.

Reference: "Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv." Zheng H., Lu L., Wang B., Pu S., Zhang X., Zhu G., Shi W., Zhang L., Wang H., Wang S., Zhao G., Zhang Y. PLoS ONE 3:E2375-E2375(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Malate synthase family, GlcB subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A5U3K4

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose