Recombinant Mycobacterium paratuberculosis Probable transcriptional regulatory protein MAP_1030 (MAP_1030) | CSB-YP352276MLAa0

Recombinant Mycobacterium paratuberculosis Probable transcriptional regulatory protein MAP_1030 (MAP_1030) | CSB-YP352276MLAa0 | Cusabio

Alternative Name(s): MAP_1030; Probable transcriptional regulatory protein MAP_1030

Gene Names: MAP_1030

Research Areas: Others

Organism: Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)

AA Sequence: MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-250aa

Sequence Info: Full Length

MW: 28.3

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "The complete genome sequence of Mycobacterium avium subspecies paratuberculosis." Li L., Bannantine J.P., Zhang Q., Amonsin A., May B.J., Alt D., Banerji N., Kanjilal S., Kapur V. Proc. Natl. Acad. Sci. U.S.A. 102:12344-12349(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P62039

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A