Cusabio Active Proteins
Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial (Active) | CSB-AP005321MO
- SKU:
- CSB-AP005321MO
- Availability:
- 5 to 10 Working Days
Description
Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4) ,partial (Active) | CSB-AP005321MO | Cusabio
Protein Description: Extracellular Domain
Alternative Name (s) : Tumor necrosis factor receptor superfamily member 4;Tnfrsf4;OX40;CD134;Txgp1
Gene Names: Tnfrsf4
Research Areas: Cancer
Species: Mus musculus (Mouse)
Source: Mammalian cell
Tag Info: C-terminal Fc-tagged
Expression Region: 20-211aa
Sequence Info: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Biological Activity: The ED50 as determined by its ability to bind Mouse TNFSF4 in functional ELISA is less than 2 ug/ml.
MW: 48.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Relevance: OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity) .
Involvement in disease:
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families:
Tissue Specificity:
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P47741
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A