Recombinant Mouse Transthyretin (Ttr), partial | CSB-EP025270MO1

Recombinant Mouse Transthyretin (Ttr), partial | CSB-EP025270MO1 | Cusabio

Alternative Name(s): Prealbumin

Gene Names: Ttr

Research Areas: Neuroscience

Organism: Mus musculus (Mouse)

AA Sequence: AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-147aa

Sequence Info: Partial

MW: 29.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Reference: "Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides." Bernhard O.K., Kapp E.A., Simpson R.J. J. Proteome Res. 6:987-995(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Transthyretin family

Tissue Specificity: Detected in plasma (at protein level). Detected in liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07309

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A