Recombinant Mouse Tenomodulin (Tnmd), partial | CSB-YP024007MO

Recombinant Mouse Tenomodulin (Tnmd), partial | CSB-YP024007MO | Cusabio

Alternative Name(s): Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)

Gene Names: Tnmd

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

Expression Region: 51-317aa

Sequence Info: Partial

MW: 34.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May be an angiogenesis inhibitor.

Reference: "Synovial joint morphogenesis requires the chondrogenic action of Sox5 and Sox6 in growth plate and articular cartilage." Dy P., Smits P., Silvester A., Penzo-Mendez A., Dumitriu B., Han Y., de la Motte C.A., Kingsley D.M., Lefebvre V. Dev. Biol. 341:346-359(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be an angiogenesis inhibitor.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein, Nucleus envelope

Protein Families: Chondromodulin-1 family

Tissue Specificity: Widely expressed with highest expression in tendons and ligaments, in the diaphragm, eye and skeletal muscle. Expressed in neuronal cells of all brain regions. Very low expression, if any, in glial cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9EP64

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A