Cusabio Mouse Recombinants
Recombinant Mouse Tenomodulin (Tnmd), partial | CSB-EP024007MO
- SKU:
- CSB-EP024007MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Tenomodulin (Tnmd), partial | CSB-EP024007MO | Cusabio
Alternative Name(s): Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)
Gene Names: Tnmd
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 51-317aa
Sequence Info: Partial
MW: 35.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: May be an angiogenesis inhibitor.
Reference: "Chondromodulin I is dispensable during enchondral ossification and eye development." Brandau O., Aszodi A., Hunziker E.B., Neame P.J., Vestweber D., Fassler R. Mol. Cell. Biol. 22:6627-6635(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-81?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 5? for up to one week.
Function: May be an angiogenesis inhibitor.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type II membrane protein, Nucleus envelope
Protein Families: Chondromodulin-1 family
Tissue Specificity: Widely expressed with highest expression in tendons and ligaments, in the diaphragm, eye and skeletal muscle. Expressed in neuronal cells of all brain regions. Very low expression, if any, in glial cells.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9EP64
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A