Recombinant Mouse Solute carrier family 2, facilitated glucose transporter member 1 (Slc2a1), partial | CSB-EP021546MO

(No reviews yet) Write a Review
SKU:
CSB-EP021546MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Solute carrier family 2, facilitated glucose transporter member 1 (Slc2a1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€460.00 - €1,810.00

Description

Recombinant Mouse Solute carrier family 2, facilitated glucose transporter member 1 (Slc2a1), partial | CSB-EP021546MO | Cusabio

Alternative Name(s): Glucose transporter type 1, erythrocyte/brain

Gene Names: Slc2a1

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV

Source: E.coli

Tag Info: Tag-Free

Expression Region: 451-492aa

Sequence Info: Partial

MW: 4.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:17320047). Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (By similarity). Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity).

Reference: "Implications of glucose transporter protein type 1 (GLUT1)-haplodeficiency in embryonic stem cells for their survival in response to hypoxic stress." Heilig C., Brosius F., Siu B., Concepcion L., Mortensen R., Heilig K., Zhu M., Weldon R., Wu G., Conner D. Am. J. Pathol. 163:1873-1885(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17809

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose